| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
| Protein automated matches [190243] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187016] (3 PDB entries) |
| Domain d3qrff_: 3qrf F: [184593] automated match to d2a07f1 protein/DNA complex; complexed with mg |
PDB Entry: 3qrf (more details), 2.8 Å
SCOPe Domain Sequences for d3qrff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qrff_ a.4.5.14 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
vrvesekgavwtvdelefrkkr
Timeline for d3qrff_: