Lineage for d3qrff_ (3qrf F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693320Protein automated matches [190243] (2 species)
    not a true protein
  7. 2693321Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)
  8. 2693332Domain d3qrff_: 3qrf F: [184593]
    automated match to d2a07f1
    protein/DNA complex; complexed with mg

Details for d3qrff_

PDB Entry: 3qrf (more details), 2.8 Å

PDB Description: structure of a domain-swapped foxp3 dimer
PDB Compounds: (F:) Forkhead box protein P3

SCOPe Domain Sequences for d3qrff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qrff_ a.4.5.14 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf
vrvesekgavwtvdelefrkkr

SCOPe Domain Coordinates for d3qrff_:

Click to download the PDB-style file with coordinates for d3qrff_.
(The format of our PDB-style files is described here.)

Timeline for d3qrff_: