Lineage for d3qrcb_ (3qrc B:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1058226Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 1058227Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 1058268Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 1058269Protein automated matches [191257] (1 species)
    not a true protein
  7. 1058270Species Yersinia pestis [TaxId:632] [189816] (2 PDB entries)
  8. 1058273Domain d3qrcb_: 3qrc B: [184592]
    automated match to d1orma_
    complexed with c8e, scr

Details for d3qrcb_

PDB Entry: 3qrc (more details), 1.85 Å

PDB Description: The crystal structure of Ail, the attachment invasion locus protein of Yersinia pestis, in complex with the heparin analogue sucrose octasulfate
PDB Compounds: (B:) Attachment invasion locus protein

SCOPe Domain Sequences for d3qrcb_:

Sequence, based on SEQRES records: (download)

>d3qrcb_ f.4.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
glqfnphpnfvidasyeysklddvkvgtwmlgagyrf

Sequence, based on observed residues (ATOM records): (download)

>d3qrcb_ f.4.1.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
lidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglq
fnphpnfvidasyeysklddvkvgtwmlgagyrf

SCOPe Domain Coordinates for d3qrcb_:

Click to download the PDB-style file with coordinates for d3qrcb_.
(The format of our PDB-style files is described here.)

Timeline for d3qrcb_: