![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.4.1: OMPA-like [56925] (5 families) ![]() forms (8,10) barrel |
![]() | Family f.4.1.0: automated matches [191664] (1 protein) not a true family |
![]() | Protein automated matches [191257] (6 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:632] [189816] (4 PDB entries) |
![]() | Domain d3qrca_: 3qrc A: [184591] automated match to d1orma_ complexed with c8e |
PDB Entry: 3qrc (more details), 1.85 Å
SCOPe Domain Sequences for d3qrca_:
Sequence, based on SEQRES records: (download)
>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga glqfnphpnfvidasyeysklddvkvgtwmlgagyrf
>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]} megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvl idgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglqf nphpnfvidasyeysklddvkvgtwmlgagyrf
Timeline for d3qrca_: