SCOPe 2.08: Domain d3qrca_: 3qrc A:

Lineage for d3qrca_ (3qrc A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.0: automated matches [191664] (1 protein)
   not a true family

6. Protein automated matches [191257] (6 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [189816] (4 PDB entries)

8. Domain d3qrca_: 3qrc A: [184591]
   automated match to d1orma_
   complexed with c8e

Details for d3qrca_

PDB Entry: 3qrc, 1.85 Å

PDB Description: the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate

PDB Compounds: (A:) Attachment invasion locus protein

SCOPe Domain Sequences for d3qrca_:

Sequence, based on SEQRES records:

>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
glqfnphpnfvidasyeysklddvkvgtwmlgagyrf

Sequence, based on observed residues (ATOM records):

>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvl
idgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglqf
nphpnfvidasyeysklddvkvgtwmlgagyrf

Timeline for d3qrca_:

• d3qrca_ first appeared in SCOPe 2.01
  
• d3qrca_ appears in SCOPe 2.07