Lineage for d3qrca_ (3qrc A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021955Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3021956Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 3022041Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 3022042Protein automated matches [191257] (6 species)
    not a true protein
  7. 3022073Species Yersinia pestis [TaxId:632] [189816] (4 PDB entries)
  8. 3022075Domain d3qrca_: 3qrc A: [184591]
    automated match to d1orma_
    complexed with c8e

Details for d3qrca_

PDB Entry: 3qrc (more details), 1.85 Å

PDB Description: the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate
PDB Compounds: (A:) Attachment invasion locus protein

SCOPe Domain Sequences for d3qrca_:

Sequence, based on SEQRES records: (download)

>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
glqfnphpnfvidasyeysklddvkvgtwmlgagyrf

Sequence, based on observed residues (ATOM records): (download)

>d3qrca_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvl
idgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslaygaglqf
nphpnfvidasyeysklddvkvgtwmlgagyrf

SCOPe Domain Coordinates for d3qrca_:

Click to download the PDB-style file with coordinates for d3qrca_.
(The format of our PDB-style files is described here.)

Timeline for d3qrca_: