Lineage for d3qraa_ (3qra A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575768Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2575769Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2575840Family f.4.1.0: automated matches [191664] (1 protein)
    not a true family
  6. 2575841Protein automated matches [191257] (5 species)
    not a true protein
  7. 2575870Species Yersinia pestis [TaxId:632] [189816] (4 PDB entries)
  8. 2575871Domain d3qraa_: 3qra A: [184590]
    automated match to d1orma_
    complexed with c8e

Details for d3qraa_

PDB Entry: 3qra (more details), 1.8 Å

PDB Description: The crystal structure of Ail, the attachment invasion locus protein of Yersinia pestis
PDB Compounds: (A:) Attachment invasion locus protein

SCOPe Domain Sequences for d3qraa_:

Sequence, based on SEQRES records: (download)

>d3qraa_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvd
gfklidgdfkyysvtagpvfrineyvslygllgaghgkakfssifgqsesrsktslayga
glqfnphpnfvidasyeysklddvkvgtwmlgagyrf

Sequence, based on observed residues (ATOM records): (download)

>d3qraa_ f.4.1.0 (A:) automated matches {Yersinia pestis [TaxId: 632]}
megessisigyaqsrvkedgykldknprgfnlkyryefnndwgvigsfaqtrrgfeesvl
idgdfkyysvtagpvfrineyvslygllgaghgkakfssfgqsesrsktslaygaglqfn
phpnfvidasyeysklddvkvgtwmlgagyrf

SCOPe Domain Coordinates for d3qraa_:

Click to download the PDB-style file with coordinates for d3qraa_.
(The format of our PDB-style files is described here.)

Timeline for d3qraa_: