SCOP 1.55: Domain d1crkb1: 1crk B:1-98

Lineage for d1crkb1 (1crk B:1-98)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.83: Guanido kinases [48033] (1 superfamily)

4. Superfamily a.83.1: Guanido kinases [48034] (1 family)

5. Family a.83.1.1: Guanido kinases [48035] (2 proteins)

6. Protein Creatine kinase, N-terminal domain [48036] (5 species)

7. Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [48037] (1 PDB entry)

8. Domain d1crkb1: 1crk B:1-98 [18459]
   Other proteins in same PDB: d1crka2, d1crkb2, d1crkc2, d1crkd2

Details for d1crkb1

PDB Entry: 1crk, 3 Å

PDB Description: mitochondrial creatine kinase

SCOP Domain Sequences for d1crkb1:

Sequence; same for both SEQRES and ATOM records:

>d1crkb1 a.83.1.1 (B:1-98) Creatine kinase, N-terminal domain {Chicken (Gallus gallus), mitochondria}
tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg
hpfiktvgmvagdeesyevfaeifdpvikarhngydpr

Timeline for d1crkb1:

• d1crkb1 appears in SCOP 1.57
  
• d1crkb1 appears in the current release, SCOPe 2.08