Lineage for d3qqtb_ (3qqt B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824711Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 2824712Superfamily b.138.1: Hydrophobin II, HfbII [101751] (2 families) (S)
    automatically mapped to Pfam PF06766
  5. 2824713Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
    a self-assembling amphiphile
  6. 2824714Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 2824715Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)
  8. 2824723Domain d3qqtb_: 3qqt B: [184585]
    automated match to d1r2ma_
    complexed with sds, so4

Details for d3qqtb_

PDB Entry: 3qqt (more details), 1.9 Å

PDB Description: Amphiphilic nanotubes in the crystal structure of a biosurfactant protein hydrophobin HFBII
PDB Compounds: (B:) Hydrophobin-2

SCOPe Domain Sequences for d3qqtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqtb_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigt

SCOPe Domain Coordinates for d3qqtb_:

Click to download the PDB-style file with coordinates for d3qqtb_.
(The format of our PDB-style files is described here.)

Timeline for d3qqtb_: