SCOPe 2.07: Domain d3qqoe1: 3qqo E:10-324

Lineage for d3qqoe1 (3qqo E:10-324)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (19 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)

8. Domain d3qqoe1: 3qqo E:10-324 [184583]
   Other proteins in same PDB: d3qqoa2, d3qqob_, d3qqoc2, d3qqod_, d3qqoe2, d3qqof_
   automated match to d1jsma_
   complexed with nag; mutant

Details for d3qqoe1

PDB Entry: 3qqo, 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form

PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d3qqoe1:

Sequence; same for both SEQRES and ATOM records:

>d3qqoe1 b.19.1.2 (E:10-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpkyvkseklvlatglrnvp

Timeline for d3qqoe1:

• d3qqoe1 first appeared in SCOPe 2.01, called d3qqoe_
  
• d3qqoe1 appears in SCOPe 2.06
  
• d3qqoe1 appears in the current release, SCOPe 2.08