Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (6 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries) |
Domain d3qqoe_: 3qqo E: [184583] Other proteins in same PDB: d3qqob_, d3qqod_, d3qqof_ automated match to d1jsma_ complexed with nag; mutant |
PDB Entry: 3qqo (more details), 2.9 Å
SCOPe Domain Sequences for d3qqoe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qqoe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti gecpkyvkseklvlatglrnvp
Timeline for d3qqoe_: