Lineage for d3qqoc1 (3qqo C:10-325)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385642Domain d3qqoc1: 3qqo C:10-325 [184582]
    Other proteins in same PDB: d3qqoa2, d3qqob_, d3qqoc2, d3qqod_, d3qqoe2, d3qqof_
    automated match to d1jsma_
    complexed with nag; mutant

Details for d3qqoc1

PDB Entry: 3qqo (more details), 2.9 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, acidic ph form
PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d3qqoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqoc1 b.19.1.2 (C:10-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d3qqoc1:

Click to download the PDB-style file with coordinates for d3qqoc1.
(The format of our PDB-style files is described here.)

Timeline for d3qqoc1: