Lineage for d3qqea1 (3qqe A:10-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775663Domain d3qqea1: 3qqe A:10-325 [184580]
    Other proteins in same PDB: d3qqea2, d3qqeb_
    automated match to d1jsma_
    complexed with edo, nag, peg; mutant

Details for d3qqea1

PDB Entry: 3qqe (more details), 2.1 Å

PDB Description: crystal structure of ha2 r106h mutant of h2 hemagglutinin, re- neutralized form
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3qqea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qqea1 b.19.1.2 (A:10-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpkyvkseklvlatglrnvpq

SCOPe Domain Coordinates for d3qqea1:

Click to download the PDB-style file with coordinates for d3qqea1.
(The format of our PDB-style files is described here.)

Timeline for d3qqea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qqea2
View in 3D
Domains from other chains:
(mouse over for more information)
d3qqeb_