Lineage for d3qq8b_ (3qq8 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178341Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2178361Protein automated matches [191298] (1 species)
    not a true protein
  7. 2178362Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)
  8. 2178365Domain d3qq8b_: 3qq8 B: [184576]
    Other proteins in same PDB: d3qq8a1, d3qq8a2
    automated match to d1h8ca_
    complexed with cl

Details for d3qq8b_

PDB Entry: 3qq8 (more details), 2 Å

PDB Description: Crystal structure of p97-N in complex with FAF1-UBX
PDB Compounds: (B:) fas-associated factor 1

SCOPe Domain Sequences for d3qq8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq8b_ d.15.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aepvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldp
nksllevklfpqetlfleak

SCOPe Domain Coordinates for d3qq8b_:

Click to download the PDB-style file with coordinates for d3qq8b_.
(The format of our PDB-style files is described here.)

Timeline for d3qq8b_: