![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (5 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [189845] (2 PDB entries) |
![]() | Domain d3qq4b_: 3qq4 B: [184575] automated match to d1bmga_ |
PDB Entry: 3qq4 (more details), 2.1 Å
SCOPe Domain Sequences for d3qq4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qq4b_ b.1.1.2 (B:) beta2-microglobulin {Pig (Sus scrofa) [TaxId: 9823]} fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh
Timeline for d3qq4b_: