Lineage for d3qq4b1 (3qq4 B:3-100)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746764Species Pig (Sus scrofa) [TaxId:9823] [189845] (2 PDB entries)
  8. 2746765Domain d3qq4b1: 3qq4 B:3-100 [184575]
    Other proteins in same PDB: d3qq4b2
    automated match to d1bmga_

Details for d3qq4b1

PDB Entry: 3qq4 (more details), 2.1 Å

PDB Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3qq4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq4b1 b.1.1.2 (B:3-100) beta2-microglobulin {Pig (Sus scrofa) [TaxId: 9823]}
varppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdws
fyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

SCOPe Domain Coordinates for d3qq4b1:

Click to download the PDB-style file with coordinates for d3qq4b1.
(The format of our PDB-style files is described here.)

Timeline for d3qq4b1: