SCOPe 2.08: Domain d3qq4b1: 3qq4 B:3-100

Lineage for d3qq4b1 (3qq4 B:3-100)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [189845] (2 PDB entries)

8. Domain d3qq4b1: 3qq4 B:3-100 [184575]
   Other proteins in same PDB: d3qq4b2
   automated match to d1bmga_

Details for d3qq4b1

PDB Entry: 3qq4, 2.1 Å

PDB Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3qq4b1:

Sequence; same for both SEQRES and ATOM records:

>d3qq4b1 b.1.1.2 (B:3-100) beta2-microglobulin {Pig (Sus scrofa) [TaxId: 9823]}
varppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdws
fyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

Timeline for d3qq4b1:

• d3qq4b1 first appeared in SCOPe 2.01, called d3qq4b_
  
• d3qq4b1 appears in SCOPe 2.07