Lineage for d3qq3e_ (3qq3 E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106649Species Pig (Sus scrofa) [TaxId:9823] [189845] (2 PDB entries)
  8. 1106652Domain d3qq3e_: 3qq3 E: [184574]
    automated match to d1bmga_

Details for d3qq3e_

PDB Entry: 3qq3 (more details), 2.59 Å

PDB Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3qq3e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qq3e_ b.1.1.2 (E:) beta2-microglobulin {Pig (Sus scrofa) [TaxId: 9823]}
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

SCOPe Domain Coordinates for d3qq3e_:

Click to download the PDB-style file with coordinates for d3qq3e_.
(The format of our PDB-style files is described here.)

Timeline for d3qq3e_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3qq3b_