SCOPe 2.01: Domain d3qq3b_: 3qq3 B:

Lineage for d3qq3b_ (3qq3 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [189845] (2 PDB entries)

8. Domain d3qq3b_: 3qq3 B: [184573]
   automated match to d1bmga_

Details for d3qq3b_

PDB Entry: 3qq3, 2.59 Å

PDB Description: Crystal structure of swine major histocompatibility complex class I SLA-1 0401 and identification of 2009 pandemic swine-origin influenza A H1N1 virus cytotoxic T lymphocyte epitope peptides

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3qq3b_:

Sequence; same for both SEQRES and ATOM records:

>d3qq3b_ b.1.1.2 (B:) beta2-microglobulin {Pig (Sus scrofa) [TaxId: 9823]}
fvarppkvqvysrhpaengkpnylncyvsgfhppqieidllkngekmnaeqsdlsfskdw
sfyllvhteftpnavdqyscrvkhvtldkpkivkwdrdh

Timeline for d3qq3b_:

• d3qq3b_ is new in SCOPe 2.01-stable
  
• d3qq3b_ appears in SCOPe 2.02
  
• d3qq3b_ appears in the current release, SCOPe 2.08, called d3qq3b1