Lineage for d1qc7b_ (1qc7 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49435Fold a.82: FliG C-terminal domain [48028] (1 superfamily)
  4. 49436Superfamily a.82.1: FliG C-terminal domain [48029] (1 family) (S)
  5. 49437Family a.82.1.1: FliG C-terminal domain [48030] (1 protein)
  6. 49438Protein FliG C-terminal domain [48031] (1 species)
  7. 49439Species Thermotoga maritima [TaxId:243274] [48032] (1 PDB entry)
  8. 49441Domain d1qc7b_: 1qc7 B: [18457]

Details for d1qc7b_

PDB Entry: 1qc7 (more details), 2.2 Å

PDB Description: t. maritima flig c-terminal domain

SCOP Domain Sequences for d1qc7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qc7b_ a.82.1.1 (B:) FliG C-terminal domain {Thermotoga maritima}
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiv

SCOP Domain Coordinates for d1qc7b_:

Click to download the PDB-style file with coordinates for d1qc7b_.
(The format of our PDB-style files is described here.)

Timeline for d1qc7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qc7a_