Lineage for d3qq0b_ (3qq0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086286Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries)
  8. 2086328Domain d3qq0b_: 3qq0 B: [184566]
    automated match to d1g7ua_
    complexed with cl, gol, na; mutant

Details for d3qq0b_

PDB Entry: 3qq0 (more details), 1.9 Å

PDB Description: Crystal structure of a deletion mutant (N59) of 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d3qq0b_:

Sequence, based on SEQRES records: (download)

>d3qq0b_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkars
sihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtdl
vvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlgf
gvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpdp
klakcdgpsalplhlledflirikalddliksqpil

Sequence, based on observed residues (ATOM records): (download)

>d3qq0b_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkars
sihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtdl
vvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlgf
gvmkqtcgnlpvifdvthslrraqaldlalagmatrlaglfleshlledflirikalddl
iksqpil

SCOPe Domain Coordinates for d3qq0b_:

Click to download the PDB-style file with coordinates for d3qq0b_.
(The format of our PDB-style files is described here.)

Timeline for d3qq0b_: