Lineage for d1qc7a_ (1qc7 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5048Fold a.82: FliG C-terminal domain [48028] (1 superfamily)
  4. 5049Superfamily a.82.1: FliG C-terminal domain [48029] (1 family) (S)
  5. 5050Family a.82.1.1: FliG C-terminal domain [48030] (1 protein)
  6. 5051Protein FliG C-terminal domain [48031] (1 species)
  7. 5052Species Thermotoga maritima [TaxId:243274] [48032] (1 PDB entry)
  8. 5053Domain d1qc7a_: 1qc7 A: [18456]

Details for d1qc7a_

PDB Entry: 1qc7 (more details), 2.2 Å

PDB Description: t. maritima flig c-terminal domain

SCOP Domain Sequences for d1qc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qc7a_ a.82.1.1 (A:) FliG C-terminal domain {Thermotoga maritima}
mfvfedilklddrsiqlvlrevdtrdlalalkgasdelkekifknmskraaallkdeley
mgpvrlkdveeaqqkiiniirrleeageiviargggeelim

SCOP Domain Coordinates for d1qc7a_:

Click to download the PDB-style file with coordinates for d1qc7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qc7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qc7b_