Lineage for d3qpya_ (3qpy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086072Family c.1.10.4: Class I DAHP synthetase [51599] (3 protein domains)
  6. 2086269Protein automated matches [190083] (8 species)
    not a true protein
  7. 2086286Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries)
  8. 2086335Domain d3qpya_: 3qpy A: [184557]
    automated match to d1d9ea_
    complexed with cl, gol, na; mutant

Details for d3qpya_

PDB Entry: 3qpy (more details), 1.95 Å

PDB Description: Crystal structure of a mutant (K57A) of 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis
PDB Compounds: (A:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d3qpya_:

Sequence, based on SEQRES records: (download)

>d3qpya_ c.1.10.4 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdaanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqtrdagsaasggrraqaldlalagmatrlaglfleshpd
pklakcdgpsalplhlledflirikalddliksqpi

Sequence, based on observed residues (ATOM records): (download)

>d3qpya_ c.1.10.4 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdaanr
ssihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtd
lvvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlg
fgvmkqtcgnlpvifdvthslqgrraqaldlalagmatrlaglfleslhlledflirika
lddliksqpi

SCOPe Domain Coordinates for d3qpya_:

Click to download the PDB-style file with coordinates for d3qpya_.
(The format of our PDB-style files is described here.)

Timeline for d3qpya_: