SCOPe 2.08: Domain d3qpfa_: 3qpf A:

Lineage for d3qpfa_ (3qpf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (23 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189664] (3 PDB entries)

8. Domain d3qpfa_: 3qpf A: [184553]
   automated match to d2nvpa1
   complexed with edo

Details for d3qpfa_

PDB Entry: 3qpf, 2.15 Å

PDB Description: analysis of a new family of widely distributed metal-independent alpha-mannosidases provides unique insight into the processing of n- linked glycans, streptococcus pneumoniae sp_2144 apo-structure

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3qpfa_:

Sequence; same for both SEQRES and ATOM records:

>d3qpfa_ a.102.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
dyldir

Timeline for d3qpfa_:

• d3qpfa_ first appeared in SCOPe 2.01
  
• d3qpfa_ appears in SCOPe 2.07