Class a: All alpha proteins [46456] (290 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
Protein automated matches [190108] (23 species) not a true protein |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189664] (3 PDB entries) |
Domain d3qpfa_: 3qpf A: [184553] automated match to d2nvpa1 complexed with edo |
PDB Entry: 3qpf (more details), 2.15 Å
SCOPe Domain Sequences for d3qpfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qpfa_ a.102.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl dyldir
Timeline for d3qpfa_: