Class a: All alpha proteins [46456] (289 folds) |
Fold a.81: N-terminal domain of DnaB helicase [48023] (1 superfamily) 6 helices: array |
Superfamily a.81.1: N-terminal domain of DnaB helicase [48024] (1 family) automatically mapped to Pfam PF00772 |
Family a.81.1.1: N-terminal domain of DnaB helicase [48025] (1 protein) |
Protein N-terminal domain of DnaB helicase [48026] (1 species) |
Species Escherichia coli [TaxId:562] [48027] (2 PDB entries) |
Domain d1jwea_: 1jwe A: [18455] CASP3 |
PDB Entry: 1jwe (more details)
SCOPe Domain Sequences for d1jwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jwea_ a.81.1.1 (A:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]} mkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspid litlaeslerqgqldsvggfaylaelskntpsaanisayadivreravvremis
Timeline for d1jwea_: