Lineage for d1jwea_ (1jwe A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004444Fold a.81: N-terminal domain of DnaB helicase [48023] (1 superfamily)
    6 helices: array
  4. 2004445Superfamily a.81.1: N-terminal domain of DnaB helicase [48024] (1 family) (S)
    automatically mapped to Pfam PF00772
  5. 2004446Family a.81.1.1: N-terminal domain of DnaB helicase [48025] (1 protein)
  6. 2004447Protein N-terminal domain of DnaB helicase [48026] (1 species)
  7. 2004448Species Escherichia coli [TaxId:562] [48027] (2 PDB entries)
  8. 2004453Domain d1jwea_: 1jwe A: [18455]
    CASP3

Details for d1jwea_

PDB Entry: 1jwe (more details)

PDB Description: nmr structure of the n-terminal domain of e. coli dnab helicase
PDB Compounds: (A:) protein (dnab helicase)

SCOPe Domain Sequences for d1jwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jwea_ a.81.1.1 (A:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]}
mkvpphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspid
litlaeslerqgqldsvggfaylaelskntpsaanisayadivreravvremis

SCOPe Domain Coordinates for d1jwea_:

Click to download the PDB-style file with coordinates for d1jwea_.
(The format of our PDB-style files is described here.)

Timeline for d1jwea_: