Lineage for d3qoma1 (3qom A:1-478)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083972Species Lactobacillus plantarum [TaxId:1590] [189663] (4 PDB entries)
  8. 2083973Domain d3qoma1: 3qom A:1-478 [184549]
    Other proteins in same PDB: d3qoma2
    automated match to d1bgaa_
    complexed with act, bgc, po4

Details for d3qoma1

PDB Entry: 3qom (more details), 1.5 Å

PDB Description: Crystal structure of 6-phospho-beta-glucosidase from Lactobacillus plantarum
PDB Compounds: (A:) 6-phospho-beta-glucosidase

SCOPe Domain Sequences for d3qoma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qoma1 c.1.8.0 (A:1-478) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mtikgrafpegflwggavaahqleggykeggkglstadimtlgtnerpreitdgvvagky
ypnhqaidfyhrypedielfaemgfkcfrtsiawtrifpngdesepneaglqfyddlfde
clkngiqpvvtlahfempyhlvkqyggwrnrkliqfylnfakvcferyrdkvtywmtfne
innqtnfesdgamltdsgiihqpgenrerwmyqaahyelvasaaavqlghqinpdfqigc
miamcpiypltaapadvlfaqramqtrfyfadvhcngtypqwlrnrfesehfnlditaed
lkilqagtvdyigfsyymsftvkdtgklayneehdlvknpyvkasdwgwqvdpvglryam
nwftdryhlplfivenglgaidkktadnqihddyridyltdhlrqiklavledgvdligy
tpwgcidlvaastgqmskrygfiyvdenddgsgslkrykkdsftwfqhviatngaeie

SCOPe Domain Coordinates for d3qoma1:

Click to download the PDB-style file with coordinates for d3qoma1.
(The format of our PDB-style files is described here.)

Timeline for d3qoma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qoma2