Lineage for d3qoja_ (3qoj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1787539Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 1787540Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1787541Protein Staphylococcal nuclease [50201] (1 species)
  7. 1787542Species Staphylococcus aureus [TaxId:1280] [50202] (227 PDB entries)
    Uniprot P00644 89-223
  8. 1787558Domain d3qoja_: 3qoj A: [184547]
    automated match to d1joka_
    complexed with ca, thp

Details for d3qoja_

PDB Entry: 3qoj (more details), 1.6 Å

PDB Description: Cryogenic structure of Staphylococcal nuclease variant D+PHS/V23K
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3qoja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qoja_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtkklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3qoja_:

Click to download the PDB-style file with coordinates for d3qoja_.
(The format of our PDB-style files is described here.)

Timeline for d3qoja_: