SCOPe 2.01: Domain d3qndg_: 3qnd G:

Lineage for d3qndg_ (3qnd G:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)

6. Protein automated matches [190333] (3 species)
   not a true protein

7. Species Human adenovirus 37 [TaxId:52275] [188823] (6 PDB entries)

8. Domain d3qndg_: 3qnd G: [184541]
   automated match to d1uxaa_
   complexed with sia, zn

Details for d3qndg_

PDB Entry: 3qnd, 2.4 Å

PDB Description: crystal structure of ad37 fiber knob in complex with trivalent sialic acid inhibitor

PDB Compounds: (G:) fiber protein

SCOPe Domain Sequences for d3qndg_:

Sequence; same for both SEQRES and ATOM records:

>d3qndg_ b.21.1.1 (G:) automated matches {Human adenovirus 37 [TaxId: 52275]}
dtrtlwttpdtspnctiaqdkdskltlvltkcgsqilanvslivvagkyhiinnktnpki
ksftikllfnkngvlldnsnlgkaywnfrsgnsnvstayekaigfmpnlvaypkpsnskk
yardivygtiylggkpdqpavikttfnqetgceysitfnfswsktyenvefettsftfsy
iaqe

Timeline for d3qndg_:

• d3qndg_ is new in SCOPe 2.01-stable
  
• d3qndg_ appears in SCOPe 2.02
  
• d3qndg_ appears in the current release, SCOPe 2.08