SCOPe 2.07: Domain d3qnbd_: 3qnb D:

Lineage for d3qnbd_ (3qnb D:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (30 species)
   not a true protein

7. Species Escherichia coli [TaxId:668369] [189787] (1 PDB entry)

8. Domain d3qnbd_: 3qnb D: [184535]
   automated match to d1e4dc_
   complexed with edo, so4

Details for d3qnbd_

PDB Entry: 3qnb, 1.95 Å

PDB Description: crystal structure of an engineered oxa-10 variant with carbapenemase activity, oxa-10loop24

PDB Compounds: (D:) Oxacillinase

SCOPe Domain Sequences for d3qnbd_:

Sequence; same for both SEQRES and ATOM records:

>d3qnbd_ e.3.1.1 (D:) automated matches {Escherichia coli [TaxId: 668369]}
itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
vhsktgwgmgvtpqvgwwvgwveketevyffafnmdidnesklplrksiptkimesegii
g

Timeline for d3qnbd_:

• d3qnbd_ first appeared in SCOPe 2.01
  
• d3qnbd_ appears in SCOPe 2.06
  
• d3qnbd_ appears in the current release, SCOPe 2.08