Lineage for d3qnba_ (3qnb A:)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1054403Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1054404Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1054405Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1054945Protein automated matches [190161] (13 species)
    not a true protein
  7. 1055025Species Escherichia coli [TaxId:668369] [189787] (1 PDB entry)
  8. 1055026Domain d3qnba_: 3qnb A: [184532]
    automated match to d1e4dc_
    complexed with edo, so4

Details for d3qnba_

PDB Entry: 3qnb (more details), 1.95 Å

PDB Description: crystal structure of an engineered oxa-10 variant with carbapenemase activity, oxa-10loop24
PDB Compounds: (A:) Oxacillinase

SCOPe Domain Sequences for d3qnba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qnba_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 668369]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgwgmgvtpqvgwwvgwveketevyffafnmdidnesklplrksiptkimesegi
ig

SCOPe Domain Coordinates for d3qnba_:

Click to download the PDB-style file with coordinates for d3qnba_.
(The format of our PDB-style files is described here.)

Timeline for d3qnba_: