Lineage for d3qn2a_ (3qn2 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963166Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2963190Protein automated matches [190328] (1 species)
    not a true protein
  7. 2963191Species Simian virus 40 [TaxId:10633] [187150] (2 PDB entries)
  8. 2963192Domain d3qn2a_: 3qn2 A: [184530]
    automated match to d1tbda_
    complexed with flc

Details for d3qn2a_

PDB Entry: 3qn2 (more details), 1.66 Å

PDB Description: Structure-based design of a disulfide-linked oligomeric form of the Simian Virus 40 (SV40) large T antigen DNA binding domain
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d3qn2a_:

Sequence, based on SEQRES records: (download)

>d3qn2a_ d.89.1.1 (A:) automated matches {Simian virus 40 [TaxId: 10633]}
kvedpkdfpsellsflshavcsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklatfsflickgvnkeylmysaltrdpfsvieeslpg
glkehcf

Sequence, based on observed residues (ATOM records): (download)

>d3qn2a_ d.89.1.1 (A:) automated matches {Simian virus 40 [TaxId: 10633]}
kvedpkdfpsellsflshavcsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklatfsflickgvnkeylmysaltrdpfsvieeslpg
glehcf

SCOPe Domain Coordinates for d3qn2a_:

Click to download the PDB-style file with coordinates for d3qn2a_.
(The format of our PDB-style files is described here.)

Timeline for d3qn2a_: