| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.81: N-terminal domain of DnaB helicase [48023] (1 superfamily) 6 helices: array |
Superfamily a.81.1: N-terminal domain of DnaB helicase [48024] (1 family) ![]() automatically mapped to Pfam PF00772 |
| Family a.81.1.1: N-terminal domain of DnaB helicase [48025] (1 protein) |
| Protein N-terminal domain of DnaB helicase [48026] (1 species) |
| Species Escherichia coli [TaxId:562] [48027] (2 PDB entries) |
| Domain d1b79c_: 1b79 C: [18453] |
PDB Entry: 1b79 (more details), 2.3 Å
SCOPe Domain Sequences for d1b79c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b79c_ a.81.1.1 (C:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]}
pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
laeslerqgqldsvggfaylaelskntpsaanisayadivre
Timeline for d1b79c_: