Lineage for d1b79c_ (1b79 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719224Fold a.81: N-terminal domain of DnaB helicase [48023] (1 superfamily)
    6 helices: array
  4. 2719225Superfamily a.81.1: N-terminal domain of DnaB helicase [48024] (1 family) (S)
    automatically mapped to Pfam PF00772
  5. 2719226Family a.81.1.1: N-terminal domain of DnaB helicase [48025] (1 protein)
  6. 2719227Protein N-terminal domain of DnaB helicase [48026] (1 species)
  7. 2719228Species Escherichia coli [TaxId:562] [48027] (2 PDB entries)
  8. 2719231Domain d1b79c_: 1b79 C: [18453]

Details for d1b79c_

PDB Entry: 1b79 (more details), 2.3 Å

PDB Description: n-terminal domain of dna replication protein dnab
PDB Compounds: (C:) DnaB Helicase

SCOPe Domain Sequences for d1b79c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b79c_ a.81.1.1 (C:) N-terminal domain of DnaB helicase {Escherichia coli [TaxId: 562]}
pphsieaeqsvlgglmldnerwddvaervvaddfytrphrhiftemarlqesgspidlit
laeslerqgqldsvggfaylaelskntpsaanisayadivre

SCOPe Domain Coordinates for d1b79c_:

Click to download the PDB-style file with coordinates for d1b79c_.
(The format of our PDB-style files is described here.)

Timeline for d1b79c_: