SCOPe 2.01: Domain d3qmqb_: 3qmq B:

Lineage for d3qmqb_ (3qmq B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189909] (1 PDB entry)

8. Domain d3qmqb_: 3qmq B: [184526]
   automated match to d2omoa1

Details for d3qmqb_

PDB Entry: 3qmq, 1.8 Å

PDB Description: Crystal Structure of E. coli LsrG

PDB Compounds: (B:) Autoinducer-2 (AI-2) modifying protein LsrG

SCOPe Domain Sequences for d3qmqb_:

Sequence; same for both SEQRES and ATOM records:

>d3qmqb_ d.58.4.0 (B:) automated matches {Escherichia coli [TaxId: 511145]}
smhvtlveinvhedkvdefievfrqnhlgsvqeegnlrfdvlqdpevnsrfyiyeaykde
davafhkttphyktcvakleslmtgprkkrlfnglmp

Timeline for d3qmqb_:

• d3qmqb_ is new in SCOPe 2.01-stable
  
• d3qmqb_ appears in SCOPe 2.02
  
• d3qmqb_ appears in the current release, SCOPe 2.08, called d3qmqb1