Lineage for d3qmqb_ (3qmq B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026927Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1027247Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1027248Protein automated matches [190081] (5 species)
    not a true protein
  7. 1027284Species Escherichia coli [TaxId:511145] [189909] (1 PDB entry)
  8. 1027286Domain d3qmqb_: 3qmq B: [184526]
    automated match to d2omoa1

Details for d3qmqb_

PDB Entry: 3qmq (more details), 1.8 Å

PDB Description: Crystal Structure of E. coli LsrG
PDB Compounds: (B:) Autoinducer-2 (AI-2) modifying protein LsrG

SCOPe Domain Sequences for d3qmqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qmqb_ d.58.4.0 (B:) automated matches {Escherichia coli [TaxId: 511145]}
smhvtlveinvhedkvdefievfrqnhlgsvqeegnlrfdvlqdpevnsrfyiyeaykde
davafhkttphyktcvakleslmtgprkkrlfnglmp

SCOPe Domain Coordinates for d3qmqb_:

Click to download the PDB-style file with coordinates for d3qmqb_.
(The format of our PDB-style files is described here.)

Timeline for d3qmqb_: