| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
| Protein automated matches [190081] (33 species) not a true protein |
| Species Escherichia coli [TaxId:511145] [189909] (1 PDB entry) |
| Domain d3qmqb1: 3qmq B:1-96 [184526] Other proteins in same PDB: d3qmqa2, d3qmqb2, d3qmqc2, d3qmqd2 automated match to d2omoa1 |
PDB Entry: 3qmq (more details), 1.8 Å
SCOPe Domain Sequences for d3qmqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qmqb1 d.58.4.0 (B:1-96) automated matches {Escherichia coli [TaxId: 511145]}
mhvtlveinvhedkvdefievfrqnhlgsvqeegnlrfdvlqdpevnsrfyiyeaykded
avafhkttphyktcvakleslmtgprkkrlfnglmp
Timeline for d3qmqb1: