Lineage for d1a5t_1 (1a5t 208-330)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540726Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
    core: 5 helices: bundle
  4. 540727Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
    associated with N-terminal domain from the AAA+ family of P-loop hydrolases
  5. 540728Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
    contains an extra helix
  6. 540729Protein delta prime subunit [48021] (1 species)
  7. 540730Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
  8. 540731Domain d1a5t_1: 1a5t 208-330 [18450]
    Other proteins in same PDB: d1a5t_2
    complexed with zn

Details for d1a5t_1

PDB Entry: 1a5t (more details), 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii

SCOP Domain Sequences for d1a5t_1:

Sequence, based on SEQRES records: (download)

>d1a5t_1 a.80.1.1 (208-330) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlp

Sequence, based on observed residues (ATOM records): (download)

>d1a5t_1 a.80.1.1 (208-330) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrvtnvdvpgl
vaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgvvlp

SCOP Domain Coordinates for d1a5t_1:

Click to download the PDB-style file with coordinates for d1a5t_1.
(The format of our PDB-style files is described here.)

Timeline for d1a5t_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5t_2