Lineage for d1a5t_1 (1a5t 208-330)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154555Fold a.80: DNA polymerase III clamp loader subunits, C-terminal domain [48018] (1 superfamily)
  4. 154556Superfamily a.80.1: DNA polymerase III clamp loader subunits, C-terminal domain [48019] (1 family) (S)
  5. 154557Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (4 proteins)
  6. 154558Protein delta prime subunit [48021] (1 species)
  7. 154559Species Escherichia coli [TaxId:562] [48022] (2 PDB entries)
  8. 154560Domain d1a5t_1: 1a5t 208-330 [18450]
    Other proteins in same PDB: d1a5t_2

Details for d1a5t_1

PDB Entry: 1a5t (more details), 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii
PDB Compounds: ( :)

SCOP Domain Sequences for d1a5t_1:

Sequence, based on SEQRES records: (download)

>d1a5t_1 a.80.1.1 (208-330) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlp

Sequence, based on observed residues (ATOM records): (download)

>d1a5t_1 a.80.1.1 (208-330) delta prime subunit {Escherichia coli}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrvtnvdvpgl
vaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgvvlp

SCOP Domain Coordinates for d1a5t_1:

Click to download the PDB-style file with coordinates for d1a5t_1.
(The format of our PDB-style files is described here.)

Timeline for d1a5t_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5t_2