SCOPe 2.08: Domain d1a5ta1: 1a5t A:208-330

Lineage for d1a5ta1 (1a5t A:208-330)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.80: post-AAA+ oligomerization domain-like [48018] (1 superfamily)
   core: 5 helices: bundle

4. Superfamily a.80.1: post-AAA+ oligomerization domain-like [48019] (2 families)
   associated with N-terminal domain from the AAA+ family of P-loop hydrolases

5. Family a.80.1.1: DNA polymerase III clamp loader subunits, C-terminal domain [48020] (9 proteins)
   contains an extra helix

6. Protein delta prime subunit [48021] (1 species)

7. Species Escherichia coli [TaxId:562] [48022] (4 PDB entries)
   Uniprot P28631

8. Domain d1a5ta1: 1a5t A:208-330 [18450]
   Other proteins in same PDB: d1a5ta2
   protein/DNA complex; complexed with zn

Details for d1a5ta1

PDB Entry: 1a5t, 2.2 Å

PDB Description: crystal structure of the delta prime subunit of the clamp-loader complex of escherichia coli dna polymerase iii

PDB Compounds: (A:) delta prime

SCOPe Domain Sequences for d1a5ta1:

Sequence, based on SEQRES records:

>d1a5ta1 a.80.1.1 (A:208-330) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrhhgaaqvtn
vdvpglvaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgv
vlp

Sequence, based on observed residues (ATOM records):

>d1a5ta1 a.80.1.1 (A:208-330) delta prime subunit {Escherichia coli [TaxId: 562]}
dnwqaretlcqalaysvpsgdwysllaalnheqaparlhwlatllmdalkrvtnvdvpgl
vaelanhlspsrlqailgdvchireqlmsvtginrellitdlllriehylqpgvvlp

Timeline for d1a5ta1:

• d1a5ta1 first appeared (with stable ids) in SCOP 1.55, called d1a5t_1
  
• d1a5ta1 appears in SCOPe 2.07