SCOPe 2.01: Domain d3qmka_: 3qmk A:

Lineage for d3qmka_ (3qmk A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.47: STAT-like [47654] (6 superfamilies)
   4 long helices; bundle, left-handed twist (coiled coil); right-handed superhelix

4. Superfamily a.47.4: CAPPD, an extracellular domain of amyloid beta A4 protein [109843] (2 families)
   the first three helices are longer than the fourth one and, taken separately, adopt a Spectrin repeat-like fold (46965)

5. Family a.47.4.0: automated matches [191661] (1 protein)
   not a true family

6. Protein automated matches [191241] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189704] (4 PDB entries)

8. Domain d3qmka_: 3qmk A: [184496]
   automated match to d1rw6a_
   complexed with so4

Details for d3qmka_

PDB Entry: 3qmk, 2.21 Å

PDB Description: crystal structure of the e2 domain of aplp1 in complex with heparin hexasaccharide

PDB Compounds: (A:) Amyloid-like protein 1

SCOPe Domain Sequences for d3qmka_:

Sequence; same for both SEQRES and ATOM records:

>d3qmka_ a.47.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dgvdiyfgmpgeisehegflrakmdleerrmrqinevmrewamadnqsknlpkadrqaln
ehfqsilqtleeqvsgerqrlvethatrvialindqrraalegflaalqadppqaervll
alrrylraeqkeqrhtlrhyqhvaavdpekaqqmrfqvhthlqvieervnqslglldqnp
hlaqelrpqiqellh

Timeline for d3qmka_:

• d3qmka_ is new in SCOPe 2.01-stable
  
• d3qmka_ appears in SCOPe 2.02
  
• d3qmka_ appears in the current release, SCOPe 2.08