Lineage for d3qm3e_ (3qm3 E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972775Family c.1.10.2: Class II FBP aldolase [51591] (3 proteins)
    metal-dependent
  6. 972797Protein automated matches [190642] (2 species)
    not a true protein
  7. 972798Species Campylobacter jejuni [TaxId:197] [189649] (1 PDB entry)
  8. 972803Domain d3qm3e_: 3qm3 E: [184492]
    automated match to d1b57a_
    complexed with cl, fmt, gol, so4, zn

Details for d3qm3e_

PDB Entry: 3qm3 (more details), 1.85 Å

PDB Description: 1.85 angstrom resolution crystal structure of fructose-bisphosphate aldolase (fba) from campylobacter jejuni
PDB Compounds: (E:) Fructose-bisphosphate aldolase

SCOPe Domain Sequences for d3qm3e_:

Sequence, based on SEQRES records: (download)

>d3qm3e_ c.1.10.2 (E:) automated matches {Campylobacter jejuni [TaxId: 197]}
amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggeedg
vdntgidnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilkns
qkfvkdkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreye
lknraylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn

Sequence, based on observed residues (ATOM records): (download)

>d3qm3e_ c.1.10.2 (E:) automated matches {Campylobacter jejuni [TaxId: 197]}
amgvldivkagvisgdelnkiydyakaegfaipavnvvgtdsinavleaakkvnspviiq
fsnggakfyagkncpngevlgaisgakhvhllakaygvpvilhtdhaarkllpwidglie
anaqykkthgqalfsshmldlseesleenlstcevylqkldalgvaleielgctggdntg
idnsklytqpedvalayerlgkisdkfsiaasfgnvhgvykpgnvslqpeilknsqkfvk
dkfalnsdkpinfvfhggsgselkdiknavsygvikmnidtdtqwafwdgvreyelknra
ylqgqignpegddkpnkkyydprvwlrsgeesmikrleiafedlncinkn

SCOPe Domain Coordinates for d3qm3e_:

Click to download the PDB-style file with coordinates for d3qm3e_.
(The format of our PDB-style files is described here.)

Timeline for d3qm3e_: