SCOPe 2.05: Domain d3qlxa_: 3qlx A:

Lineage for d3qlxa_ (3qlx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (19 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [188965] (7 PDB entries)

8. Domain d3qlxa_: 3qlx A: [184482]
   automated match to d1ai9a_
   complexed with ndp, qlr

Details for d3qlxa_

PDB Entry: 3qlx, 2.24 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- methyl-5-[(3r)-3-(3,4,5-trimethoxyphenyl)pent-1-yn-1-yl]pyrimidine-2, 4-diamine (ucp112a)

PDB Compounds: (A:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3qlxa_:

Sequence; same for both SEQRES and ATOM records:

>d3qlxa_ c.71.1.0 (A:) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3qlxa_:

• d3qlxa_ first appeared in SCOPe 2.01
  
• d3qlxa_ appears in SCOPe 2.04
  
• d3qlxa_ is called d3qlxa1 in SCOPe 2.06
  
• d3qlxa_ appears in the current release, SCOPe 2.08, called d3qlxa1