Lineage for d3qlsb_ (3qls B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1004246Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1004247Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1004248Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1004391Protein Dihydrofolate reductases, eukaryotic type [53605] (6 species)
  7. 1004489Species Yeast (Candida albicans) [TaxId:5476] [53609] (12 PDB entries)
  8. 1004501Domain d3qlsb_: 3qls B: [184479]
    automated match to d1ai9a_
    complexed with 55v, gly, gol, nap

Details for d3qlsb_

PDB Entry: 3qls (more details), 1.73 Å

PDB Description: candida albicans dihydrofolate reductase complexed with nadph and 6- methyl-5-[3-methyl-3-(3,4,5-trimethoxyphenyl)but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp115a)
PDB Compounds: (B:) Putative uncharacterized protein CaJ7.0360

SCOPe Domain Sequences for d3qlsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlsb_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d3qlsb_:

Click to download the PDB-style file with coordinates for d3qlsb_.
(The format of our PDB-style files is described here.)

Timeline for d3qlsb_: