Lineage for d3qlsa1 (3qls A:3-192)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511367Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2511380Domain d3qlsa1: 3qls A:3-192 [184478]
    Other proteins in same PDB: d3qlsa2, d3qlsb2
    automated match to d1ai9a_
    complexed with 55v, gly, gol, ndp

Details for d3qlsa1

PDB Entry: 3qls (more details), 1.73 Å

PDB Description: candida albicans dihydrofolate reductase complexed with nadph and 6- methyl-5-[3-methyl-3-(3,4,5-trimethoxyphenyl)but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp115a)
PDB Compounds: (A:) Putative uncharacterized protein CaJ7.0360

SCOPe Domain Sequences for d3qlsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlsa1 c.71.1.1 (A:3-192) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
kpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesi
pqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyneli
nnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdf
tynytlwtrk

SCOPe Domain Coordinates for d3qlsa1:

Click to download the PDB-style file with coordinates for d3qlsa1.
(The format of our PDB-style files is described here.)

Timeline for d3qlsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qlsa2