SCOPe 2.05: Domain d3qlsa_: 3qls A:

Lineage for d3qlsa_ (3qls A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)

8. Domain d3qlsa_: 3qls A: [184478]
   automated match to d1ai9a_
   complexed with 55v, gly, gol, ndp

Details for d3qlsa_

PDB Entry: 3qls, 1.73 Å

PDB Description: candida albicans dihydrofolate reductase complexed with nadph and 6- methyl-5-[3-methyl-3-(3,4,5-trimethoxyphenyl)but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp115a)

PDB Compounds: (A:) Putative uncharacterized protein CaJ7.0360

SCOPe Domain Sequences for d3qlsa_:

Sequence; same for both SEQRES and ATOM records:

>d3qlsa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d3qlsa_:

• d3qlsa_ first appeared in SCOPe 2.01
  
• d3qlsa_ appears in SCOPe 2.04
  
• d3qlsa_ is called d3qlsa1 in SCOPe 2.06
  
• d3qlsa_ appears in the current release, SCOPe 2.08, called d3qlsa1