SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qlrb1 (3qlr B:3-192)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2137011Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2137142Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2137168Domain d3qlrb1: 3qlr B:3-192 [184477]
    Other proteins in same PDB: d3qlra2, d3qlrb2
    automated match to d1ai9a_
    complexed with gly, gol, ndp, qlr

Details for d3qlrb1

PDB Entry: 3qlr (more details), 2.15 Å

PDB Description: Candida albicans dihydrofolate reductase complexed with NADPH and 6-methyl-5-[(3R)-3-(3,4,5-trimethoxyphenyl)pent-1-yn-1-yl]pyrimidine-2,4-diamine (UCP112A)
PDB Compounds: (B:) Putative uncharacterized protein CaJ7.0360

SCOPe Domain Sequences for d3qlrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qlrb1 c.71.1.1 (B:3-192) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
kpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwesi
pqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyneli
nnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikegdf
tynytlwtrk

SCOPe Domain Coordinates for d3qlrb1:

Click to download the PDB-style file with coordinates for d3qlrb1.
(The format of our PDB-style files is described here.)

Timeline for d3qlrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qlrb2