Lineage for d1eyvb_ (1eyv B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5022Fold a.79: Antitermination factor NusB [48012] (1 superfamily)
  4. 5023Superfamily a.79.1: Antitermination factor NusB [48013] (1 family) (S)
  5. 5024Family a.79.1.1: Antitermination factor NusB [48014] (1 protein)
  6. 5025Protein Antitermination factor NusB [48015] (2 species)
  7. 5029Species Mycobacterium tuberculosis [TaxId:1773] [48016] (1 PDB entry)
  8. 5031Domain d1eyvb_: 1eyv B: [18447]

Details for d1eyvb_

PDB Entry: 1eyv (more details), 1.6 Å

PDB Description: the crystal structure of nusb from mycobacterium tuberculosis

SCOP Domain Sequences for d1eyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyvb_ a.79.1.1 (B:) Antitermination factor NusB {Mycobacterium tuberculosis}
vrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvseha
ahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstdd
spgfvngvlgqvm

SCOP Domain Coordinates for d1eyvb_:

Click to download the PDB-style file with coordinates for d1eyvb_.
(The format of our PDB-style files is described here.)

Timeline for d1eyvb_: