SCOPe 2.08: Domain d1eyvb_: 1eyv B:

Lineage for d1eyvb_ (1eyv B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (4 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
   automatically mapped to Pfam PF01029

6. Protein Antitermination factor NusB [48015] (3 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [48016] (1 PDB entry)

8. Domain d1eyvb_: 1eyv B: [18447]
   complexed with po4

Details for d1eyvb_

PDB Entry: 1eyv, 1.6 Å

PDB Description: the crystal structure of nusb from mycobacterium tuberculosis

PDB Compounds: (B:) n-utilizing substance protein b homolog

SCOPe Domain Sequences for d1eyvb_:

Sequence; same for both SEQRES and ATOM records:

>d1eyvb_ a.79.1.1 (B:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]}
vrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvseha
ahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstdd
spgfvngvlgqvm

Timeline for d1eyvb_:

• d1eyvb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyvb_ appears in SCOPe 2.07