| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (4 families) ![]() |
| Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins) automatically mapped to Pfam PF01029 |
| Protein Antitermination factor NusB [48015] (3 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [48016] (1 PDB entry) |
| Domain d1eyvb_: 1eyv B: [18447] complexed with po4 |
PDB Entry: 1eyv (more details), 1.6 Å
SCOPe Domain Sequences for d1eyvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyvb_ a.79.1.1 (B:) Antitermination factor NusB {Mycobacterium tuberculosis [TaxId: 1773]}
vrgrhqarkravallfeaevrgisaaevvdtraalaeakpdiarlhpytaavargvseha
ahiddlitahlrgwtldrlpavdrailrvsvwellhaadvpepvvvdeavqlakelstdd
spgfvngvlgqvm
Timeline for d1eyvb_: