Lineage for d3qkjc_ (3qkj C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047114Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2047215Family b.34.9.2: PWWP domain [69250] (6 protein domains)
    includes the C-terminal all-alpha subdomain
  6. 2047235Protein automated matches [190966] (1 species)
    not a true protein
  7. 2047236Species Human (Homo sapiens) [TaxId:9606] [188600] (8 PDB entries)
  8. 2047242Domain d3qkjc_: 3qkj C: [184468]
    automated match to d1khca_
    protein/DNA complex; complexed with btb, so4

Details for d3qkjc_

PDB Entry: 3qkj (more details), 2.04 Å

PDB Description: the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta in complex with a bis-tris molecule
PDB Compounds: (C:) DNA cytosine-5 methyltransferase 3 beta isoform 6 variant

SCOPe Domain Sequences for d3qkjc_:

Sequence, based on SEQRES records: (download)

>d3qkjc_ b.34.9.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmlew
ahggfkptgieglkpn

Sequence, based on observed residues (ATOM records): (download)

>d3qkjc_ b.34.9.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsad
klvalglfsqhfnlatfnklvsyrkamyhalekarvragktfdsledqlkpmlewahggf
kptgieglkpn

SCOPe Domain Coordinates for d3qkjc_:

Click to download the PDB-style file with coordinates for d3qkjc_.
(The format of our PDB-style files is described here.)

Timeline for d3qkjc_: