SCOPe 2.05: Domain d3qkjb_: 3qkj B:

Lineage for d3qkjb_ (3qkj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (7 PDB entries)

8. Domain d3qkjb_: 3qkj B: [184467]
   automated match to d1khca_
   protein/DNA complex; complexed with btb, so4

Details for d3qkjb_

PDB Entry: 3qkj, 2.04 Å

PDB Description: the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta in complex with a bis-tris molecule

PDB Compounds: (B:) DNA cytosine-5 methyltransferase 3 beta isoform 6 variant

SCOPe Domain Sequences for d3qkjb_:

Sequence, based on SEQRES records:

>d3qkjb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle
wahggfkptgieglkpnn

Sequence, based on observed residues (ATOM records):

>d3qkjb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpledqlkpmlewahggf
kptgieglkpnn

Timeline for d3qkjb_:

• d3qkjb_ first appeared in SCOPe 2.01
  
• d3qkjb_ appears in SCOPe 2.04
  
• d3qkjb_ appears in SCOPe 2.06
  
• d3qkjb_ appears in the current release, SCOPe 2.08