![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
![]() | Protein automated matches [190966] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188600] (9 PDB entries) |
![]() | Domain d3qkjb_: 3qkj B: [184467] automated match to d1khca_ protein/DNA complex; complexed with btb, so4 |
PDB Entry: 3qkj (more details), 2.04 Å
SCOPe Domain Sequences for d3qkjb_:
Sequence, based on SEQRES records: (download)
>d3qkjb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle wahggfkptgieglkpnn
>d3qkjb_ b.34.9.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpledqlkpmlewahggf kptgieglkpnn
Timeline for d3qkjb_: