Lineage for d3qkja_ (3qkj A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394294Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 2394316Protein automated matches [190966] (1 species)
    not a true protein
  7. 2394317Species Human (Homo sapiens) [TaxId:9606] [188600] (18 PDB entries)
  8. 2394320Domain d3qkja_: 3qkj A: [184466]
    automated match to d1khca_
    protein/DNA complex; complexed with btb, so4

Details for d3qkja_

PDB Entry: 3qkj (more details), 2.04 Å

PDB Description: the pwwp domain of human dna (cytosine-5-)-methyltransferase 3 beta in complex with a bis-tris molecule
PDB Compounds: (A:) DNA cytosine-5 methyltransferase 3 beta isoform 6 variant

SCOPe Domain Sequences for d3qkja_:

Sequence, based on SEQRES records: (download)

>d3qkja_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpsspgdsledqlkpmle
wahggfkptgieglkpn

Sequence, based on observed residues (ATOM records): (download)

>d3qkja_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seyqdgkefgigdlvwgkikgfswwpamvvswkatskrqamsgmrwvqwfgdgkfsevsa
dklvalglfsqhfnlatfnklvsyrkamyhalekarvragktfpedqlkpmlewahggfk
ptgieglkpn

SCOPe Domain Coordinates for d3qkja_:

Click to download the PDB-style file with coordinates for d3qkja_.
(The format of our PDB-style files is described here.)

Timeline for d3qkja_: