Lineage for d3qk8e_ (3qk8 E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585495Species Mycobacterium marinum [TaxId:216594] [189638] (3 PDB entries)
  8. 1585500Domain d3qk8e_: 3qk8 E: [184462]
    automated match to d1wz8a1
    complexed with cl, edo, unl

Details for d3qk8e_

PDB Entry: 3qk8 (more details), 1.6 Å

PDB Description: crystal structure of enoyl-coa hydratase echa15 from mycobacterium marinum in complex with an unknown ligand
PDB Compounds: (E:) Enoyl-CoA hydratase EchA15

SCOPe Domain Sequences for d3qk8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qk8e_ c.14.1.0 (E:) automated matches {Mycobacterium marinum [TaxId: 216594]}
tyqdfpslrfepgehgvlnlvldspglnsvgpqmhrdladvwpvidrdpdvrvvlvrgeg
kafssggsfelidetigdyegririmreardlvlnlvnldkpvvsairgpavgaglvval
ladisvasatakiidghtklgvaagdhaaicwpllvgmakakyylltcetlsgeeaerig
lvstcvdddevlptatrlaenlaqgaqnairwtkrslnhwyrmfgptfetslgleflgft
gpdvqeglaahrqkrparf

SCOPe Domain Coordinates for d3qk8e_:

Click to download the PDB-style file with coordinates for d3qk8e_.
(The format of our PDB-style files is described here.)

Timeline for d3qk8e_: