Lineage for d3qk2a_ (3qk2 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034235Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1034236Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1034237Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1034238Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 1034239Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)
  8. 1034243Domain d3qk2a_: 3qk2 A: [184457]
    automated match to d1tbda_
    complexed with scn

Details for d3qk2a_

PDB Entry: 3qk2 (more details), 1.64 Å

PDB Description: Structure-Based Analysis of the Interaction between the Simian Virus 40 T-Antigen Origin Binding Domain and Single-Stranded DNA
PDB Compounds: (A:) large t antigen

SCOPe Domain Sequences for d3qk2a_:

Sequence, based on SEQRES records: (download)

>d3qk2a_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnpes

Sequence, based on observed residues (ATOM records): (download)

>d3qk2a_ d.89.1.1 (A:) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
gskvedpkdfpsellsflshafsnrtlacfaiyttkekaallykkimekysvtfisrhns
ynhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslp
gglkehdfnpes

SCOPe Domain Coordinates for d3qk2a_:

Click to download the PDB-style file with coordinates for d3qk2a_.
(The format of our PDB-style files is described here.)

Timeline for d3qk2a_: