Lineage for d3qk1a_ (3qk1 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954562Species Cow (Bos taurus) [TaxId:9913] [187001] (7 PDB entries)
  8. 954569Domain d3qk1a_: 3qk1 A: [184456]
    automated match to d1aq7a_
    complexed with ben, ca, edo, gol, imd, so4

Details for d3qk1a_

PDB Entry: 3qk1 (more details), 2.08 Å

PDB Description: Crystal Structure of Enterokinase-like Trypsin Variant
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3qk1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qk1a_ b.47.1.2 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynkrrknndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasnh

SCOPe Domain Coordinates for d3qk1a_:

Click to download the PDB-style file with coordinates for d3qk1a_.
(The format of our PDB-style files is described here.)

Timeline for d3qk1a_: